McDonnell Genome Institute

Washington University

Transcript

lnc-SIPA1-2:1

Chromosome

chr11

Gene Name

lnc-SIPA1-2

Start

65662973

CPC Label

noncoding

End

65664725

Cancer

CCRC

Strand

+

Peptide

AGFLTAK

Modified Peptide

n[230]AGFLTAK

Peptide Length

7

ORF Length

185

Open Reading Frame (ORF)

LEQSQGYWAAAARPAQGKARPGLLLRRGRVVELRAGFLTAKGAFRWWLSQKHVKMSYPPQSRCGCGGMGAAGPPSLTVHQELCGAYSPDGTTEALPLASWPRARPSPAKAPAYDTAKLPALIGCGSRRPPGVNPGASSLKPGACVSEGAGPTGTLESAGSRPPTPLPPPVFALDLQLGLTTNSVM

Conservation Score

0.997

PhyloCSF Frame 1

1.853

No. of Spectra

31

CPC Coding Probability

0.229215

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9946

PhyloCSF Frame 3

0

CNTI Score

-0.273960764