McDonnell Genome Institute

Washington University

Transcript

lnc-SIK1B-187:1

Chromosome

chr21

Gene Name

lnc-SIK1B-187

Start

6318433

CPC Label

noncoding

End

6360415

Cancer

BRCA-Luminal A

Strand

+

Peptide

FNNNIIQMSLK

Modified Peptide

n[145]FNNNIIQMSLK

Peptide Length

11

ORF Length

75

Open Reading Frame (ORF)

LTHLYCDLLRTHTSCSWEIAVYNSNKWGKFNNNIIQMSLKAGHVFKAYTTWAYICTTIIIYKLQFGWELKVQKIC

Conservation Score

0.815

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0607206

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1937

PhyloCSF Frame 3

0

CNTI Score

-0.436646948