McDonnell Genome Institute

Washington University

Transcript

lnc-SHROOM2-1:1

Chromosome

chrX

Gene Name

lnc-SHROOM2-1

Start

9639819

CPC Label

noncoding

End

9645395

Cancer

LUAD

Strand

+

Peptide

LLASSNQPASASQSAGINRR

Modified Peptide

n[230]LLASSNQPASASQSAGINRR

Peptide Length

20

ORF Length

66

Open Reading Frame (ORF)

LSSWDYRRAPQRPVNFFVFLVDMGFCYVGQSGLKLLASSNQPASASQSAGINRREPPCPVRDDFIL

Conservation Score

0.286

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.0290744

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9974

PhyloCSF Frame 3

0

CNTI Score

-0.396402478