McDonnell Genome Institute

Washington University

Transcript

lnc-SHQ1-3:1

Chromosome

chr3

Gene Name

lnc-SHQ1-3

Start

73397051

CPC Label

noncoding

End

73398814

Cancer

OV

Strand

-

Peptide

LLCFRGVSLWSVSSRR

Modified Peptide

n[145]LLCFRGVSLWSVSSRR

Peptide Length

16

ORF Length

51

Open Reading Frame (ORF)

LLCFRGVSLWSVSSRRLINKPRMLRNEFPQVGPVFRETGTCLSSLLLHEIS

Conservation Score

0.13

PhyloCSF Frame 1

-4.078

No. of Spectra

3

CPC Coding Probability

0.0179142

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5415

PhyloCSF Frame 3

0

CNTI Score

-0.375297702