McDonnell Genome Institute

Washington University

Transcript

lnc-SHQ1-2:1

Chromosome

chr3

Gene Name

lnc-SHQ1-2

Start

72993470

CPC Label

noncoding

End

72997112

Cancer

OV

Strand

-

Peptide

AGGSLETSPATCLYK

Modified Peptide

n[145]AGGSLETSPATCLYK

Peptide Length

15

ORF Length

41

Open Reading Frame (ORF)

LQLLEPPTGWAWWLTPVISVLWEAKAGGSLETSPATCLYKK

Conservation Score

0.267

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.12801

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6347

PhyloCSF Frame 3

0

CNTI Score

-0.336585304