McDonnell Genome Institute

Washington University

Transcript

lnc-SHQ1-1:1

Chromosome

chr3

Gene Name

lnc-SHQ1-1

Start

72663306

CPC Label

noncoding

End

72664253

Cancer

CCRC

Strand

-

Peptide

VFTASAVALLLSGGLR

Modified Peptide

n[230]VFTASAVALLLSGGLR

Peptide Length

16

ORF Length

55

Open Reading Frame (ORF)

LPPWKKDLERRMGSQPDGRVFTASAVALLLSGGLRKVTTHSPSGKLQLGFELTKS

Conservation Score

1

PhyloCSF Frame 1

-4.887

No. of Spectra

20

CPC Coding Probability

0.0353769

PhyloCSF Frame 2 

-5.051

CNTI Index

noncoding

Max Probability

0.998

PhyloCSF Frame 3

-4.704

CNTI Score

-0.423888624