McDonnell Genome Institute

Washington University

Transcript

lnc-SHPRH-7:1

Chromosome

chr6

Gene Name

lnc-SHPRH-7

Start

146948527

CPC Label

noncoding

End

146951159

Cancer

OSCC

Strand

-

Peptide

LFVCIGGSSLNLFLNLCK

Modified Peptide

n[145]LFVCIGGSSLNLFLNLCK

Peptide Length

18

ORF Length

127

Open Reading Frame (ORF)

LSLFPTPRFKIDPSNNDAICLAPPEFYILTRPSAVVLILVMRMECVFSSCNYLLQATKMDFELVQRCQHLLIFRLFVCIGGSSLNLFLNLCKIASPTHSGHIPEMGKWEISLLIGNFSLECDHVARI

Conservation Score

1

PhyloCSF Frame 1

-5.438

No. of Spectra

2

CPC Coding Probability

0.157428

PhyloCSF Frame 2 

-3.868

CNTI Index

noncoding

Max Probability

0.852

PhyloCSF Frame 3

-4.206

CNTI Score

-0.319795575