McDonnell Genome Institute

Washington University

Transcript

lnc-SHPRH-10:2

Chromosome

chr6

Gene Name

lnc-SHPRH-10

Start

147201915

CPC Label

noncoding

End

147203057

Cancer

OV

Strand

-

Peptide

LIFIELVDSLGATTK

Modified Peptide

n[145]LIFIELVDSLGATTK

Peptide Length

15

ORF Length

39

Open Reading Frame (ORF)

LICRLIFIELVDSLGATTKKTNVRTFLNYFQVALNFLLI

Conservation Score

0.992

PhyloCSF Frame 1

-3.501

No. of Spectra

3

CPC Coding Probability

0.164682

PhyloCSF Frame 2 

-5.791

CNTI Index

noncoding

Max Probability

0.6103

PhyloCSF Frame 3

-5.733

CNTI Score

-0.398128241