McDonnell Genome Institute

Washington University

Transcript

lnc-SHOX2-7:1

Chromosome

chr3

Gene Name

lnc-SHOX2-7

Start

158275808

CPC Label

noncoding

End

158276421

Cancer

BRCA-Luminal B

Strand

-

Peptide

APHPIWPDK

Modified Peptide

n[145]APHPIWPDK

Peptide Length

9

ORF Length

112

Open Reading Frame (ORF)

MGAYKHIQELWRKQPDVIMRFLLRVCCWQYRQLSALHRAPHPIWPDKLCRLGCKAKKGYIIYRIRIRHGGRKCPVPKGATYGKPVHHGVNQLKFAHSFSPLQRSELDATVGL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.433356

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9658

PhyloCSF Frame 3

0

CNTI Score

-0.33780336