McDonnell Genome Institute

Washington University

Transcript

lnc-SHOX2-3:1

Chromosome

chr3

Gene Name

lnc-SHOX2-3

Start

158155871

CPC Label

noncoding

End

158158407

Cancer

OV

Strand

-

Peptide

KPMLISHFENPRALKNYAK

Modified Peptide

n[145]KPMLISHFENPRALKNYAK

Peptide Length

19

ORF Length

117

Open Reading Frame (ORF)

MRFKKRTHLHNIKVQGEAVRADRGPAASNPEDTAKITDEGGYAKQQIFNADKTASIGRRCHLGLIGREEKSMPGYKASKDRQTLLLGVNPPGDFKRKPMLISHFENPRALKNYAKST

Conservation Score

0.88

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.166376

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4298

PhyloCSF Frame 3

0

CNTI Score

-0.330542526