McDonnell Genome Institute

Washington University

Transcript

lnc-SHMT1-1:1

Chromosome

chr17

Gene Name

lnc-SHMT1-1

Start

18379854

CPC Label

coding

End

18388984

Cancer

OV

Strand

-

Peptide

HDAALCAQDPPPAAGWGERK

Modified Peptide

n[145]HDAALCAQDPPPAAGWGERK

Peptide Length

20

ORF Length

252

Open Reading Frame (ORF)

LPPCRCPRAHPAVVLHVLELGLLADAQVQEVLPLHLQGLLVGLGTAARSPRTTPRPRTHVHPPLPRPPRPFSLSPCPQRTWMGPTAGCRSSTMRLPSSSSWFTLCSWLSSSCCLKCWGRVGWGAAVRTRMALVAPAWPQPLPADLVFPPHARRVGHEVAPVLLQDAALLLRQGAQLPRAALQCVYRLPRLCPRHDAALCAQDPPPAAGWGERKWGAKGAIGRRSGTLAPGRVRAATQAHLQPPCPTLPPAHQ

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

15

CPC Coding Probability

0.992185

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9045

PhyloCSF Frame 3

0

CNTI Score

-0.245832856