McDonnell Genome Institute

Washington University

Transcript

lnc-SHISAL1-2:1

Chromosome

chr22

Gene Name

lnc-SHISAL1-2

Start

44210441

CPC Label

coding

End

44229512

Cancer

LUAD

Strand

-

Peptide

AGGAGMGVGMALAALIHCQK

Modified Peptide

n[230]AGGAGMGVGMALAALIHCQK

Peptide Length

20

ORF Length

41

Open Reading Frame (ORF)

LLTTAQVLQGKKAGGAGMGVGMALAALIHCQKIWGQEHTFL

Conservation Score

0.449

PhyloCSF Frame 1

-3.153

No. of Spectra

1

CPC Coding Probability

0.965015

PhyloCSF Frame 2 

-4.013

CNTI Index

noncoding

Max Probability

0.1427

PhyloCSF Frame 3

-3.388

CNTI Score

-0.289378717