McDonnell Genome Institute

Washington University

Transcript

lnc-SHISAL1-1:1

Chromosome

chr22

Gene Name

lnc-SHISAL1-1

Start

44183030

CPC Label

noncoding

End

44187739

Cancer

OV

Strand

-

Peptide

YHSMVGIAAWSVWNLSSGTTLLGLR

Modified Peptide

n[145]YHSM[147]VGIAAWSVWNLSSGTTLLGLR

Peptide Length

25

ORF Length

96

Open Reading Frame (ORF)

LKGRPIVVELLHPMLTPLLKGTHTCEGSTSGAPHPAKYHSMVGIAAWSVWNLSSGTTLLGLRTQVHHLLRVSCYCGTSPLVPQFPHLYKAGTDARP

Conservation Score

0.043

PhyloCSF Frame 1

-1.876

No. of Spectra

1

CPC Coding Probability

0.469352

PhyloCSF Frame 2 

-2.399

CNTI Index

noncoding

Max Probability

0.9944

PhyloCSF Frame 3

-2.469

CNTI Score

-0.289943109