McDonnell Genome Institute

Washington University

Transcript

lnc-SHISA9-1:2

Chromosome

chr16

Gene Name

lnc-SHISA9-1

Start

12753019

CPC Label

noncoding

End

12761080

Cancer

OSCC

Strand

+

Peptide

ALFSMMSSLSDFK

Modified Peptide

n[145]ALFSM[147]MSSLSDFK

Peptide Length

13

ORF Length

38

Open Reading Frame (ORF)

LALFPFMTSVQPPTSPLTKALFSMMSSLSDFKTQTLHH

Conservation Score

0.007

PhyloCSF Frame 1

-5.554

No. of Spectra

3

CPC Coding Probability

0.392693

PhyloCSF Frame 2 

-5.904

CNTI Index

noncoding

Max Probability

0.6825

PhyloCSF Frame 3

-4.175

CNTI Score

-0.363032806