McDonnell Genome Institute

Washington University

Transcript

lnc-SHISA5-2:1

Chromosome

chr3

Gene Name

lnc-SHISA5-2

Start

48464205

CPC Label

noncoding

End

48465884

Cancer

CCRC

Strand

-

Peptide

GEVPGEGPK

Modified Peptide

n[230]GEVPGEGPK

Peptide Length

9

ORF Length

114

Open Reading Frame (ORF)

MWLDTQGLSHTPPRGLPHRFPRHRGHPGLPLRQKGEVPGEGPKVPGPRAGPTSPPPTSAGTNQSLPHPGPAPSATANKVIQRQFRHGYFWKNRGSARHTQQIDAKGIPICLEKN

Conservation Score

1

PhyloCSF Frame 1

-3.911

No. of Spectra

14

CPC Coding Probability

0.180102

PhyloCSF Frame 2 

1.244

CNTI Index

noncoding

Max Probability

0.9925

PhyloCSF Frame 3

8.66

CNTI Score

-0.290936248