McDonnell Genome Institute

Washington University

Transcript

lnc-SHISA2-4:1

Chromosome

chr13

Gene Name

lnc-SHISA2-4

Start

25863249

CPC Label

noncoding

End

25863667

Cancer

PRAD

Strand

-

Peptide

GPGRPGQEAFGCLGR

Modified Peptide

GPGRPGQEAFGCLGR

Peptide Length

15

ORF Length

53

Open Reading Frame (ORF)

LPLWPSVHTGLDMERGPGRPGQEAFGCLGRKQGVLGAQRLQVGRWTLCIIAFH

Conservation Score

0.166

PhyloCSF Frame 1

-5.857

No. of Spectra

3

CPC Coding Probability

0.112941

PhyloCSF Frame 2 

-6.011

CNTI Index

noncoding

Max Probability

0.9782

PhyloCSF Frame 3

-4.309

CNTI Score

-0.383754732