McDonnell Genome Institute

Washington University

Transcript

lnc-SHC3-10:1

Chromosome

chr9

Gene Name

lnc-SHC3-10

Start

88514928

CPC Label

noncoding

End

88534540

Cancer

CRC

Strand

-

Peptide

AFESCLGALAARPSTLEEASGR

Modified Peptide

AFESCLGALAARPSTLEEASGR

Peptide Length

22

ORF Length

191

Open Reading Frame (ORF)

LRPAHTPAPSRPWALPSWALSPALLHFLPTQRPALRPAPPIASCASPTPCSSSSFTSSHSSRSPSAPHAAPPPKPRVALLPSWPLFQSRAPCRAPPQVSRSRLPRAFESCLGALAARPSTLEEASGRMGRRGRGRVIGLGAGLGGVVGNLSSVGSGCLPLTSCGLAGRVREVQEEIGSSPYRMFYLKNQEY

Conservation Score

0.75

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.179967

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8178

PhyloCSF Frame 3

0

CNTI Score

-0.319718726