McDonnell Genome Institute

Washington University

Transcript

lnc-SHB-1:4

Chromosome

chr9

Gene Name

lnc-SHB-1

Start

38070203

CPC Label

noncoding

End

38072085

Cancer

OV

Strand

-

Peptide

STFLENFSALR

Modified Peptide

n[145]STFLENFSALR

Peptide Length

11

ORF Length

108

Open Reading Frame (ORF)

LALLSALTVPTVTTGYGKNRLPQSTSITDRQQMQIIDLGYCFSKSTFLENFSALRCPHLRVKSHFEGCPGKFKAAPGPSGSYFIFRQHFPLNREHATSPGCRSQEKLH

Conservation Score

0.945

PhyloCSF Frame 1

-4.324

No. of Spectra

2

CPC Coding Probability

0.0508831

PhyloCSF Frame 2 

-2.252

CNTI Index

noncoding

Max Probability

0.9916

PhyloCSF Frame 3

-3.794

CNTI Score

-0.396361601