McDonnell Genome Institute

Washington University

Transcript

lnc-SHB-1:2

Chromosome

chr9

Gene Name

lnc-SHB-1

Start

38071267

CPC Label

noncoding

End

38072086

Cancer

BRCA-Luminal B

Strand

-

Peptide

TFLSQVAWPIAR

Modified Peptide

n[145]TFLSQVAWPIAR

Peptide Length

12

ORF Length

37

Open Reading Frame (ORF)

LEKAEITFPCARHMQGASFQILVRTFLSQVAWPIARI

Conservation Score

1

PhyloCSF Frame 1

-3.312

No. of Spectra

1

CPC Coding Probability

0.128622

PhyloCSF Frame 2 

-4.622

CNTI Index

noncoding

Max Probability

0.9968

PhyloCSF Frame 3

-5.467

CNTI Score

-0.446627312