McDonnell Genome Institute

Washington University

Transcript

lnc-SHANK2-5:3

Chromosome

chr11

Gene Name

lnc-SHANK2-5

Start

70206128

CPC Label

noncoding

End

70208988

Cancer

OSCC

Strand

-

Peptide

IVCVGCGLR

Modified Peptide

n[145]IVCVGCGLR

Peptide Length

9

ORF Length

42

Open Reading Frame (ORF)

LERMVTEGVRGPRDSGRTKMLQQPVTSARIVCVGCGLRSTRE

Conservation Score

0.007

PhyloCSF Frame 1

-4.412

No. of Spectra

1

CPC Coding Probability

0.0511021

PhyloCSF Frame 2 

-3.356

CNTI Index

noncoding

Max Probability

0.1128

PhyloCSF Frame 3

-3.499

CNTI Score

-0.315612684