McDonnell Genome Institute

Washington University

Transcript

lnc-SH3YL1-1:4

Chromosome

chr2

Gene Name

lnc-SH3YL1-1

Start

260511

CPC Label

noncoding

End

264810

Cancer

OV

Strand

-

Peptide

KCGTGLNR

Modified Peptide

n[145]KCGTGLNR

Peptide Length

8

ORF Length

44

Open Reading Frame (ORF)

LKFGSNARAWNVRGTRGRRGEEALARAPARKCGTGLNRLTTLRK

Conservation Score

0.006

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0820049

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9693

PhyloCSF Frame 3

0

CNTI Score

-0.338054119