McDonnell Genome Institute

Washington University

Transcript

lnc-SH3RF2-5:1

Chromosome

chr5

Gene Name

lnc-SH3RF2-5

Start

146138770

CPC Label

noncoding

End

146139008

Cancer

EOGC

Strand

+

Peptide

AKNQTVTPGGKPNK

Modified Peptide

n[145]AKNQTVTPGGKPNK

Peptide Length

14

ORF Length

64

Open Reading Frame (ORF)

MCYVYKAKNQTVTPGGKPNKTRVIWGKVTQAHGNSSMVHAKFLNNLPAKAIGHRIGVMLYPSRI

Conservation Score

1

PhyloCSF Frame 1

-4.66

No. of Spectra

4

CPC Coding Probability

0.062185

PhyloCSF Frame 2 

-4.854

CNTI Index

noncoding

Max Probability

0.6446

PhyloCSF Frame 3

-2.966

CNTI Score

-0.430609925