McDonnell Genome Institute

Washington University

Transcript

lnc-SH3RF2-4:1

Chromosome

chr5

Gene Name

lnc-SH3RF2-4

Start

146137754

CPC Label

noncoding

End

146138381

Cancer

CCRC

Strand

+

Peptide

IEVFMLK

Modified Peptide

IEVFMLK

Peptide Length

7

ORF Length

61

Open Reading Frame (ORF)

MSPEHTALLKIEVFMLKMKQNSMWARDVLMYTKQRTTMTPGSKPNKTRVIWGKVTRAPWEQ

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

17

CPC Coding Probability

0.075345

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9168

PhyloCSF Frame 3

0

CNTI Score

-0.418468709