McDonnell Genome Institute

Washington University

Transcript

lnc-SH3BP2-1:2

Chromosome

chr4

Gene Name

lnc-SH3BP2-1

Start

2761820

CPC Label

noncoding

End

2769326

Cancer

CCRC

Strand

+

Peptide

WEVDGSR

Modified Peptide

n[230]WEVDGSR

Peptide Length

7

ORF Length

40

Open Reading Frame (ORF)

MAPVGLLPGTSSPPGSPGSNSAGRWEVDGSRQAWEGSAGV

Conservation Score

0.811

PhyloCSF Frame 1

0

No. of Spectra

20

CPC Coding Probability

0.325945

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9958

PhyloCSF Frame 3

0

CNTI Score

-0.303203281