McDonnell Genome Institute

Washington University

Transcript

lnc-SH3BGRL2-5:1

Chromosome

chr6

Gene Name

lnc-SH3BGRL2-5

Start

79573876

CPC Label

noncoding

End

79575530

Cancer

OV

Strand

+

Peptide

FSSLCCYSIAFSSK

Modified Peptide

n[145]FSSLCCYSIAFSSK

Peptide Length

14

ORF Length

50

Open Reading Frame (ORF)

LSLGRTAGDRERFSSLCCYSIAFSSKIIFMSRKHFWGKIFWFSSLCNKLF

Conservation Score

0.737

PhyloCSF Frame 1

0

No. of Spectra

12

CPC Coding Probability

0.0068749

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9779

PhyloCSF Frame 3

0

CNTI Score

-0.42563186