McDonnell Genome Institute

Washington University

Transcript

lnc-SH3BGRL-5:11

Chromosome

chrX

Gene Name

lnc-SH3BGRL-5

Start

80810099

CPC Label

noncoding

End

80847560

Cancer

OV

Strand

+

Peptide

KLDESVLSK

Modified Peptide

n[145]KLDESVLSK

Peptide Length

9

ORF Length

43

Open Reading Frame (ORF)

LSLMHQVRAIYKPFVMFSRKLDESVLSKEKSLKMVSLSISLHG

Conservation Score

0.835

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.0602031

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8131

PhyloCSF Frame 3

0

CNTI Score

-0.367114063