McDonnell Genome Institute

Washington University

Transcript

lnc-SH3BGRL-4:1

Chromosome

chrX

Gene Name

lnc-SH3BGRL-4

Start

81600071

CPC Label

noncoding

End

81601306

Cancer

PRAD

Strand

+

Peptide

ISLLSHNLLR

Modified Peptide

‚Äč

Peptide Length

10

ORF Length

42

Open Reading Frame (ORF)

LPIKLANIIKRISLLSHNLLRTSSIQLVQSLYIQSLQEHLDF

Conservation Score

1

PhyloCSF Frame 1

-5.078

No. of Spectra

2

CPC Coding Probability

0.0378791

PhyloCSF Frame 2 

-4.042

CNTI Index

noncoding

Max Probability

0.9987

PhyloCSF Frame 3

-5.385

CNTI Score

-0.423866025