McDonnell Genome Institute

Washington University

Transcript

lnc-SH2D7-3:6

Chromosome

chr15

Gene Name

lnc-SH2D7-3

Start

77991845

CPC Label

coding

End

77994024

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

LETSHIPK

Modified Peptide

n[145]LETSHIPK

Peptide Length

8

ORF Length

83

Open Reading Frame (ORF)

LRSPRATRMQACRCALWSSAWSWGGGACLLPRALCRAWGMSQAQGWLLSSCSSCWSKQGLGFVSSSGSSRSKARRLETSHIPK

Conservation Score

0.821

PhyloCSF Frame 1

-3.675

No. of Spectra

1

CPC Coding Probability

0.988729

PhyloCSF Frame 2 

-3.384

CNTI Index

noncoding

Max Probability

0.3424

PhyloCSF Frame 3

-1.349

CNTI Score

-0.277450763