McDonnell Genome Institute

Washington University

Transcript

lnc-SH2D7-2:3

Chromosome

chr15

Gene Name

lnc-SH2D7-2

Start

78131566

CPC Label

noncoding

End

78147160

Cancer

OV

Strand

+

Peptide

TGQSQSMFISQSLSSK

Modified Peptide

n[145]TGQSQSMFISQSLSSK

Peptide Length

16

ORF Length

41

Open Reading Frame (ORF)

MKTGQSQSMFISQSLSSKYSLCTSLCSRNNVIRDHQDYLWT

Conservation Score

0.965

PhyloCSF Frame 1

0

No. of Spectra

37

CPC Coding Probability

0.0126426

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.945

PhyloCSF Frame 3

0

CNTI Score

-0.391470908