McDonnell Genome Institute

Washington University

Transcript

lnc-SH2D4A-5:1

Chromosome

chr8

Gene Name

lnc-SH2D4A-5

Start

19135997

CPC Label

noncoding

End

19189627

Cancer

OV

Strand

+

Peptide

ADGAVLTDKR

Modified Peptide

n[145]ADGAVLTDKR

Peptide Length

10

ORF Length

47

Open Reading Frame (ORF)

MAACCSMIFITLLWHLDYKIFSAPRRYSQKAICTESRADGAVLTDKR

Conservation Score

0.037

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0260318

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1657

PhyloCSF Frame 3

0

CNTI Score

-0.381632098