McDonnell Genome Institute

Washington University

Transcript

lnc-SH2D4A-4:1

Chromosome

chr8

Gene Name

lnc-SH2D4A-4

Start

19237736

CPC Label

coding

End

19241912

Cancer

OV

Strand

+

Peptide

LWHHFCFVNLMVEK

Modified Peptide

n[145]LWHHFCFVNLMVEK

Peptide Length

14

ORF Length

44

Open Reading Frame (ORF)

MLLLPSLWQLKRLWHHFCFVNLMVEKNLSCPFIKLVYNNFIYSV

Conservation Score

1

PhyloCSF Frame 1

-5.237

No. of Spectra

1

CPC Coding Probability

0.930654

PhyloCSF Frame 2 

-4.668

CNTI Index

noncoding

Max Probability

0.2077

PhyloCSF Frame 3

-5.086

CNTI Score

-0.300384893