McDonnell Genome Institute

Washington University

Transcript

lnc-SH2D1A-1:1

Chromosome

chrX

Gene Name

lnc-SH2D1A-1

Start

124162311

CPC Label

noncoding

End

124164545

Cancer

PRAD

Strand

+

Peptide

QIMAQSTQDSLEPK

Modified Peptide

‚Äč

Peptide Length

14

ORF Length

37

Open Reading Frame (ORF)

LHSILTITWNNTERQIMAQSTQDSLEPKISLINSFSY

Conservation Score

0.172

PhyloCSF Frame 1

0

No. of Spectra

11

CPC Coding Probability

0.077359

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.994

PhyloCSF Frame 3

0

CNTI Score

-0.380967938