McDonnell Genome Institute

Washington University

Transcript

lnc-SH2B2-5:1

Chromosome

chr7

Gene Name

lnc-SH2B2-5

Start

102041759

CPC Label

noncoding

End

102044945

Cancer

OSCC

Strand

+

Peptide

ALLLLRPFCCSLPIK

Modified Peptide

n[145]ALLLLRPFCCSLPIK

Peptide Length

15

ORF Length

55

Open Reading Frame (ORF)

LPLKYFSSFKVLDFYSGRTGLCIMSHLNILFDFLKALLLLRPFCCSLPIKLISIL

Conservation Score

0.353

PhyloCSF Frame 1

-4.266

No. of Spectra

4

CPC Coding Probability

0.237282

PhyloCSF Frame 2 

-5.492

CNTI Index

noncoding

Max Probability

0.6177

PhyloCSF Frame 3

-3.235

CNTI Score

-0.367742016