McDonnell Genome Institute

Washington University

Transcript

lnc-SGTB-6:1

Chromosome

chr5

Gene Name

lnc-SGTB-6

Start

66240879

CPC Label

coding

End

66245202

Cancer

OSCC

Strand

-

Peptide

DLPASSFSK

Modified Peptide

n[145]DLPASSFSK

Peptide Length

9

ORF Length

178

Open Reading Frame (ORF)

LQPMRDLPASSFSKARFLFLAMTSVTLMAERKGEHHPLQERERALCRKVDLTHSSLANSICRSQGGRRTQSALARPLCPSFSRHSHPDYTLCLVTIRSFISATSATIRSPGLQSICVSFLTPISYNYPPLASDILPPHLLDHTMSPQENHPLAGHNGSHLYSQNFGRLRPADCLRSGV

Conservation Score

0.33

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.595934

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.2203

PhyloCSF Frame 3

0

CNTI Score

-0.345509333