McDonnell Genome Institute

Washington University

Transcript

lnc-SGTB-4:6

Chromosome

chr5

Gene Name

lnc-SGTB-4

Start

66335172

CPC Label

noncoding

End

66440426

Cancer

OSCC

Strand

-

Peptide

KNMCSESQAK

Modified Peptide

n[145]KNM[147]CSESQAK

Peptide Length

10

ORF Length

54

Open Reading Frame (ORF)

LKHGLRVTLWSKKNMCSESQAKEFRSGQCKDSLLMYKGHLNPWPIPWNTSCIRN

Conservation Score

0.639

PhyloCSF Frame 1

0

No. of Spectra

9

CPC Coding Probability

0.063596

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9795

PhyloCSF Frame 3

0

CNTI Score

-0.331219716