McDonnell Genome Institute

Washington University

Transcript

lnc-SGTB-4:4

Chromosome

chr5

Gene Name

lnc-SGTB-4

Start

66335172

CPC Label

noncoding

End

66440426

Cancer

PRAD

Strand

-

Peptide

ITGVGSVQLLPVLLLSLLPK

Modified Peptide

‚Äč

Peptide Length

20

ORF Length

57

Open Reading Frame (ORF)

LANFRRITGVGSVQLLPVLLLSLLPKAICKGGIKQLREGKKRCEEGKKLEDPKQHDG

Conservation Score

0.689

PhyloCSF Frame 1

-3.214

No. of Spectra

2

CPC Coding Probability

0.063596

PhyloCSF Frame 2 

-5.112

CNTI Index

noncoding

Max Probability

0.7324

PhyloCSF Frame 3

-4.529

CNTI Score

-0.331219716