McDonnell Genome Institute

Washington University

Transcript

lnc-SGTB-4:1

Chromosome

chr5

Gene Name

lnc-SGTB-4

Start

66347761

CPC Label

noncoding

End

66440487

Cancer

EOGC

Strand

-

Peptide

SESLSPTIFTGR

Modified Peptide

n[145]SESLSPTIFTGR

Peptide Length

12

ORF Length

49

Open Reading Frame (ORF)

MTASEATNHRVCYVLFIRSESLSPTIFTGRQSKLYLLKERSIQEFVDIF

Conservation Score

0.972

PhyloCSF Frame 1

-5.342

No. of Spectra

50

CPC Coding Probability

0.0362432

PhyloCSF Frame 2 

-5.655

CNTI Index

noncoding

Max Probability

0.9983

PhyloCSF Frame 3

-3.969

CNTI Score

-0.38562601