McDonnell Genome Institute

Washington University

Transcript

lnc-SGSH-3:2

Chromosome

chr17

Gene Name

lnc-SGSH-3

Start

80258238

CPC Label

noncoding

End

80260438

Cancer

OSCC

Strand

-

Peptide

ALSQAMCQASEPK

Modified Peptide

n[145]ALSQAMCQASEPK

Peptide Length

13

ORF Length

56

Open Reading Frame (ORF)

LMSDASLKCINQAAPNLLGTCSQGLLRALSQAMCQASEPKLSHHIPCDLHVYIQMA

Conservation Score

0.366

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.0736962

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.817

PhyloCSF Frame 3

0

CNTI Score

-0.29897887