McDonnell Genome Institute

Washington University

Transcript

lnc-SGSH-1:3

Chromosome

chr17

Gene Name

lnc-SGSH-1

Start

80201588

CPC Label

noncoding

End

80205476

Cancer

EOGC

Strand

-

Peptide

TEGAEGTEAR

Modified Peptide

n[145]TEGAEGTEAR

Peptide Length

10

ORF Length

42

Open Reading Frame (ORF)

LRLRNQPEGKSRRSVSFPRDSESSQKTEGAEGTEARRGPALP

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

11

CPC Coding Probability

0.0702958

PhyloCSF Frame 2 

5.905

CNTI Index

noncoding

Max Probability

0.9993

PhyloCSF Frame 3

0

CNTI Score

-0.291640428