McDonnell Genome Institute

Washington University

Transcript

lnc-SGK1-5:4

Chromosome

chr6

Gene Name

lnc-SGK1-5

Start

134388916

CPC Label

noncoding

End

134422874

Cancer

BRCA-Luminal A

Strand

-

Peptide

LYHNIHNSMSVK

Modified Peptide

n[145]LYHNIHNSM[147]SVK

Peptide Length

12

ORF Length

49

Open Reading Frame (ORF)

LYHNIHNSMSVKGKKKQPNYIEPQMCRCVHRCSPPSPLQKRKFPGCLAP

Conservation Score

0.932

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.470599

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9949

PhyloCSF Frame 3

0

CNTI Score

-0.283175694