McDonnell Genome Institute

Washington University

Transcript

lnc-SGK1-3:4

Chromosome

chr6

Gene Name

lnc-SGK1-3

Start

134525516

CPC Label

noncoding

End

134539992

Cancer

OV

Strand

-

Peptide

AEVPSTESR

Modified Peptide

n[145]AEVPSTESR

Peptide Length

9

ORF Length

41

Open Reading Frame (ORF)

MAEVPSTESRSVPGWSAVVWSWLTATSASRVQAILLPQPPE

Conservation Score

0.06

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.106547

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9954

PhyloCSF Frame 3

0

CNTI Score

-0.373853795