McDonnell Genome Institute

Washington University

Transcript

lnc-SGK1-3:2

Chromosome

chr6

Gene Name

lnc-SGK1-3

Start

134525317

CPC Label

noncoding

End

134609658

Cancer

OSCC

Strand

-

Peptide

RTPPFGTK

Modified Peptide

n[145]RTPPFGTK

Peptide Length

8

ORF Length

62

Open Reading Frame (ORF)

LNHCLLCLLIQWHESKRSGGTPDQPSHHMSPDRRTPPFGTKTSLPPEPDVTGTGSNRLLVNC

Conservation Score

0.447

PhyloCSF Frame 1

-5.753

No. of Spectra

5

CPC Coding Probability

0.120463

PhyloCSF Frame 2 

-5.002

CNTI Index

noncoding

Max Probability

0.9976

PhyloCSF Frame 3

-5.555

CNTI Score

-0.353951421