McDonnell Genome Institute

Washington University

Transcript

lnc-SGCG-6:3

Chromosome

chr13

Gene Name

lnc-SGCG-6

Start

22915680

CPC Label

coding

End

22919236

Cancer

CCRC

Strand

+

Peptide

HLELDLATVPAR

Modified Peptide

n[230]HLELDLATVPAR

Peptide Length

12

ORF Length

193

Open Reading Frame (ORF)

LSAPQAHLLAPRSVRHLELDLATVPARRLCRGPSAARLHAPQVPGVCRNRHHHPHPRRGSCLPAAHHQVRWRADGPSLEKLPVHMGLVITEVEQEPSFSDIESLVVWCMAVGISYISVYDHQGIFKRNNSRLMDGILKQQQELLGLDCSKCSPEFANSNDKDDQVLNCHLAVKVLLPEDGKADIVRAAQDFCQ

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.515068

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9239

PhyloCSF Frame 3

0

CNTI Score

0.70977669