McDonnell Genome Institute

Washington University

Transcript

lnc-SGCD-4:2

Chromosome

chr5

Gene Name

lnc-SGCD-4

Start

155491335

CPC Label

noncoding

End

155493598

Cancer

BRCA-Basal-like

Strand

+

Peptide

ECDITEGK

Modified Peptide

n[145]ECDITEGK

Peptide Length

8

ORF Length

91

Open Reading Frame (ORF)

MRSRSKGRDHENVKEKEKELDSKGNDQERGRSKEKSKQLESKSNEHDHSKTKEKDRCAQSRSRECDITEGKHSYNSRTEQQSRSRDRSRRV

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.310575

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9995

PhyloCSF Frame 3

0

CNTI Score

-0.317107594