McDonnell Genome Institute

Washington University

Transcript

lnc-SGCA-4:2

Chromosome

chr17

Gene Name

lnc-SGCA-4

Start

50151273

CPC Label

noncoding

End

50155226

Cancer

OV

Strand

+

Peptide

EGLGGLPSK

Modified Peptide

n[145]EGLGGLPSK

Peptide Length

9

ORF Length

69

Open Reading Frame (ORF)

LFSGVRHQAGWPVRWVKNGVSFPPSLLCLSGAVIAPDRNKEGLGGLPSKLKALNRIFIHWAVIFTYILQ

Conservation Score

0.065

PhyloCSF Frame 1

-4.917

No. of Spectra

1

CPC Coding Probability

0.154768

PhyloCSF Frame 2 

-5.088

CNTI Index

noncoding

Max Probability

0.5516

PhyloCSF Frame 3

-5.375

CNTI Score

-0.345993372