McDonnell Genome Institute

Washington University

Transcript

lnc-SGCA-4:1

Chromosome

chr17

Gene Name

lnc-SGCA-4

Start

50151273

CPC Label

noncoding

End

50152541

Cancer

OV

Strand

+

Peptide

KGLGAGIR

Modified Peptide

n[145]KGLGAGIR

Peptide Length

8

ORF Length

52

Open Reading Frame (ORF)

LERMSCRLSAVHPSSGPYPGTPASQTGRKGLGAGIREAWGQSFASESSNLGL

Conservation Score

0.969

PhyloCSF Frame 1

-2.425

No. of Spectra

10

CPC Coding Probability

0.248562

PhyloCSF Frame 2 

-3.498

CNTI Index

noncoding

Max Probability

0.975

PhyloCSF Frame 3

-3.585

CNTI Score

-0.397621813