McDonnell Genome Institute

Washington University

Transcript

lnc-SFXN1-2:1

Chromosome

chr5

Gene Name

lnc-SFXN1-2

Start

175290730

CPC Label

noncoding

End

175291252

Cancer

OV

Strand

+

Peptide

LSISSSSDAEIK

Modified Peptide

n[145]LSISSSSDAEIK

Peptide Length

12

ORF Length

38

Open Reading Frame (ORF)

LSISSSSDAEIKVVIGYLGVIIMDDEFQLLQRNVMDKY

Conservation Score

0.998

PhyloCSF Frame 1

-4.869

No. of Spectra

2

CPC Coding Probability

0.0332274

PhyloCSF Frame 2 

-5.235

CNTI Index

noncoding

Max Probability

0.7549

PhyloCSF Frame 3

-4.947

CNTI Score

-0.408772633