McDonnell Genome Institute

Washington University

Transcript

lnc-SFTPD-6:1

Chromosome

chr10

Gene Name

lnc-SFTPD-6

Start

79892147

CPC Label

coding

End

79893175

Cancer

EOGC

Strand

-

Peptide

RSMSYDNGLAQGAGLESHGGSTFCAIASLCLMGK

Modified Peptide

n[145]RSMSYDNGLAQGAGLESHGGSTFCAIASLCLMGK

Peptide Length

34

ORF Length

228

Open Reading Frame (ORF)

LGILFNPSKAPGTAHPYDSGHIAMTYTGLSCLLILGDDLSRVNKEACLAGLRALQLEDGSFCAVPEGSENDMRFLYCTSCICYMLNNRSGMDMKKAISYIRRSMSYDNGLAQGAGLESHGGSTFCAIASLCLMGKLEEVFSEKELNRIKRWCMRQQNSYRGRPNKPVDTGYSFWVGATLKLLKIFQYTNFEKNRNYILSTQDRLVGGFAKWPVIQVLCMHTLGSVACH

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.996953

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8591

PhyloCSF Frame 3

0

CNTI Score

-0.351465566