McDonnell Genome Institute

Washington University

Transcript

lnc-SFTPC-2:3

Chromosome

chr8

Gene Name

lnc-SFTPC-2

Start

22169337

CPC Label

noncoding

End

22171710

Cancer

OV

Strand

+

Peptide

DLALCSMSK

Modified Peptide

n[145]DLALCSMSK

Peptide Length

9

ORF Length

106

Open Reading Frame (ORF)

LCWDNIKVAGGCVPCCMLCAGGSCICLISCSNPRRQILLCRRTLRLRRVYMTCQLIVANLDSKTGLSDSKDLALCSMSKGESKCPATPVCGDACGFGCGSLQVQCL

Conservation Score

0.719

PhyloCSF Frame 1

-3.933

No. of Spectra

1

CPC Coding Probability

0.295125

PhyloCSF Frame 2 

-2.534

CNTI Index

noncoding

Max Probability

0.1825

PhyloCSF Frame 3

-3.264

CNTI Score

-0.352542417