McDonnell Genome Institute

Washington University

Transcript

lnc-SFTPA2-6:1

Chromosome

chr10

Gene Name

lnc-SFTPA2-6

Start

79404302

CPC Label

noncoding

End

79406097

Cancer

OV

Strand

-

Peptide

GLAEQTGPK

Modified Peptide

n[145]GLAEQTGPK

Peptide Length

9

ORF Length

126

Open Reading Frame (ORF)

LWVEGQLGPEGEGARMPCMFHLSSAVRPKPEVGLHLSIWGDSAWPNSGGDCSRRERCSRKKGLAEQTGPKEGCARSGNNKWFSNSIVPSSNQQTAGWLQIFHPPTKAASNPCLCSGGGNLCLLQSL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.206953

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9497

PhyloCSF Frame 3

-3.077

CNTI Score

-0.304366043